Proteintech, 27959-1-AP, PHF24 Polyclonal antibody

Size: 20ul / 150ul The PHF24 (27959-1-AP) by Proteintech is a Polyclonal antibody targeting PHF24 in IHC, IF-P, ELISA applications with reactivity to Human, mouse samples 27959-1-AP targets PHF24 in IHC, IF-P, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27492 Product name: Recombinant human PHF24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-251 aa of NM_001304333 Sequence: MSAFKDGLRDRPSIRRTGELPGSRRGTVEGSVQEVQEEKEAEAGTSVVQEESSAGRAAWERLRDGRGVEPEEFDRTSRFTPPAFIRPTRKLDDDKPPEICLEPREPVVNDEMCDVCEVWTAESLFPCRVCTRVFHDGCLRRMGYIQGDSAAEVTEMAHTETGWSCHYCDNINLLLTEEEMYSLTETFQRCKVIPDCSLTLEDFLRYRHQAAKRGDRDRALSEEQEEQAARQ Predict reactive species Full Name: KIAA1045 Calculated Molecular Weight: 45 aa GenBank Accession Number: NM_001304333 Gene Symbol: PHF24 Gene ID (NCBI): 23349 RRID: AB_3086014 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UPV7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.