Iright
BRAND / VENDOR: Proteintech

Proteintech, 27969-1-AP, C1orf2 Polyclonal antibody

CATALOG NUMBER: 27969-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The C1orf2 (27969-1-AP) by Proteintech is a Polyclonal antibody targeting C1orf2 in WB, ELISA applications with reactivity to human samples 27969-1-AP targets C1orf2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information C1orf2 is also named COTE1, FAM189B and ENTREP3. C1orf2 is identified as a potential binding partner of a WW domain-containing protein which is involved in apoptosis and tumor suppression. Alternative splicing results in multiple transcript variants. COTE1 contributes to human hepatocarcinogenesis by regulating cell proliferation through the modulation of WWOX signaling, and it upregulated in hepatocellular carcinoma specimens and HCC cell lines (PMID: 23317259, PMID: 24899407). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27428 Product name: Recombinant human C1orf2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 437-654 aa of BC006493 Sequence: PELRRRVPRGGGRPAAAPPTRAPTRRFSDSSGSLTPPGHRPPHPASPPPLLLPRSHSDPGITTSSDTADFRDLYTKVLEEEAASVSSADTGLCSEACLFRLARCPSPKLLRARSAEKRRPVPTFQKVPLPSGPAPAHSLGDLKGSWPGRGLVTRFLQISRKAPDPSGTGAHGHKQVPRSLWGRPGRESLHLRSCGDLSSSSSLRRLLSGRRLERGTRP Predict reactive species Full Name: chromosome 1 open reading frame 2 Calculated Molecular Weight: 669 aa, 71 kDa Observed Molecular Weight: 69-71 kDa GenBank Accession Number: BC006493 Gene Symbol: C1orf2 Gene ID (NCBI): 10712 RRID: AB_3086017 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P81408 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924