Iright
BRAND / VENDOR: Proteintech

Proteintech, 27981-1-AP, ABLIM3 Polyclonal antibody

CATALOG NUMBER: 27981-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ABLIM3 (27981-1-AP) by Proteintech is a Polyclonal antibody targeting ABLIM3 in WB, ELISA applications with reactivity to Human, Mouse samples 27981-1-AP targets ABLIM3 in WB, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, mouse brain tissue, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Specification Tested Reactivity: Human, Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27578 Product name: Recombinant human ABLIM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 336-536 aa of BC001665 Sequence: YYRSGDLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMREYKIYPYELLLVTTRGRNRLPKDVDRTRLEG Predict reactive species Full Name: actin binding LIM protein family, member 3 Calculated Molecular Weight: 78 kDa Observed Molecular Weight: 78 kDa GenBank Accession Number: BC001665 Gene Symbol: ABLIM3 Gene ID (NCBI): 22885 RRID: AB_2881029 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94929 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924