Iright
BRAND / VENDOR: Proteintech

Proteintech, 27991-1-AP, KLKB1 Polyclonal antibody

CATALOG NUMBER: 27991-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The KLKB1 (27991-1-AP) by Proteintech is a Polyclonal antibody targeting KLKB1 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples 27991-1-AP targets KLKB1 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse pancreas tissue, rat kidney tissue, rat pancreas tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Human Plasma Kallikrein, a serine protease also named as KLKB1, KLK3, PPK or Kininogenin, is synthesized in the liver and circulates in the plasma by binding to high molecular weight (HMW) kininogen or as a free zymogen. It cleaves HMW kininogen, its major physiological substrate, to release the potent vasodilator peptide bradykinin. It is also able to cleave a number of inactive precursor proteins to generate active products, such as plasminogen and prourokinase. Thus, it plays an important role in blood pressure regulation, fibrinolysis, and neutrophil activation. KLKB1 precursor contains a signal peptide (residues 1 to 19) and a pro form sequence (residues 20 to 638). Upon activation, the pro form is converted to a heavy chain and a light chain, which is linked by disulfide bonds and the latter contains the catalytic domain (PMID: 3521732). KLKB1 is a ~70 kDa protein and can be detected as 80-86 kDa(glycosylation form), 52 kDa(heavy chain), 36-44kDa(light chain) and 18 kDa(often detected in cancer) (PMID: 17963278, 3521732). KLKB1 may be a potential candidate serum biomarker of cancer. The antigen of this antibody just cover the heavy chain of KLKB1, so this antibody cannot recognize the light chain. Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27491 Product name: Recombinant human KLKB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-348 aa of NM_000892 Sequence: MASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCF Predict reactive species Full Name: kallikrein B, plasma (Fletcher factor) 1 Calculated Molecular Weight: 71 kDa Observed Molecular Weight: 52-70 kDa GenBank Accession Number: NM_000892 Gene Symbol: KLKB1 Gene ID (NCBI): 3818 RRID: AB_2881032 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P03952 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924