Proteintech, 27994-1-AP, MAGT1 Polyclonal antibody

Size: 20ul / 150ul The MAGT1 (27994-1-AP) by Proteintech is a Polyclonal antibody targeting MAGT1 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 27994-1-AP targets MAGT1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: mouse brain tissue, NIH/3T3 cells, HuH-7 cells, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information MAGT1 is a mammalian Mg2+-selective transporter being required for cellular magnesium uptake and vertebrate embryonic development. It possesses five putative transmembrane (TM) regions with a cleavage site, a N-glycosylation site, and a number of phosphorylation sites. Recently mutations in MAGT1 has been found to be asscociated with a novel X-linked human immunodeficiency. The MAGT1 protein was undetectable in the patients' cells by western blot or immunofluorescent cell surface staining (Nature 475, 471-6). 27994-1-AP antibody detects the glycosylated protein around 45-50 kDa in SDS-PAGE. (PMID: 28720733, 27383987) Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27416 Product name: Recombinant human MAGT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 266-335 aa of BC060842 Sequence: VAETHIVLLFNGGVTLGMVLLCEAATSDMDIGKRKIMCVAGIGLVVLFFSWMLSIFRSKYHGYPYSFLMS Predict reactive species Full Name: magnesium transporter 1 Calculated Molecular Weight: 335 aa, 38 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC060842 Gene Symbol: MAGT1 Gene ID (NCBI): 84061 RRID: AB_2881033 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H0U3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.