Product Description
Size: 20ul / 150ul
The SLC22A9 (27998-1-AP) by Proteintech is a Polyclonal antibody targeting SLC22A9 in WB, IHC, ELISA applications with reactivity to human, mouse samples
27998-1-AP targets SLC22A9 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: mouse liver tissue
Positive IHC detected in: human liver cancer tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Immunohistochemistry (IHC): IHC : 1:250-1:1000
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag27573 Product name: Recombinant human SLC22A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-175 aa of BC022379 Sequence: HILDNDTVSDNDTGALSQDALLRISIPLDSNMRPEKCRRFVHPQWQLLHLNGTFPNTSDADMEPCVDGWVYDRISFSSTIVTEWDLVCDSQSLTSVAKFVFMAGMMVGGILGGHLSDSSRVGNT Predict reactive species
Full Name: solute carrier family 22 (organic anion transporter), member 9
Calculated Molecular Weight: 553 aa, 62 kDa
Observed Molecular Weight: 70 kDa
GenBank Accession Number: BC022379
Gene Symbol: SLC22A9
Gene ID (NCBI): 114571
RRID: AB_2881034
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8IVM8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924