Iright
BRAND / VENDOR: Proteintech

Proteintech, 27998-1-AP, SLC22A9 Polyclonal antibody

CATALOG NUMBER: 27998-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC22A9 (27998-1-AP) by Proteintech is a Polyclonal antibody targeting SLC22A9 in WB, IHC, ELISA applications with reactivity to human, mouse samples 27998-1-AP targets SLC22A9 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IHC detected in: human liver cancer tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27573 Product name: Recombinant human SLC22A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-175 aa of BC022379 Sequence: HILDNDTVSDNDTGALSQDALLRISIPLDSNMRPEKCRRFVHPQWQLLHLNGTFPNTSDADMEPCVDGWVYDRISFSSTIVTEWDLVCDSQSLTSVAKFVFMAGMMVGGILGGHLSDSSRVGNT Predict reactive species Full Name: solute carrier family 22 (organic anion transporter), member 9 Calculated Molecular Weight: 553 aa, 62 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC022379 Gene Symbol: SLC22A9 Gene ID (NCBI): 114571 RRID: AB_2881034 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IVM8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924