Product Description
Size: 20ul / 150ul
The LCN12 (28004-1-AP) by Proteintech is a Polyclonal antibody targeting LCN12 in WB, ELISA applications with reactivity to human, mouse, rat samples
28004-1-AP targets LCN12 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse testis tissue, rat kidney tissue, rat testis tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:8000
Background Information
LCN12 (Lipocalin 12) is an epididymis-specific protein that might play a significant physiological role in male reproduction (PMID: 20692383).
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag27402 Product name: Recombinant human LCN12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 51-177 aa of BC041168 Sequence: NSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRGQHCDTWSYVLIPAAQPGQFTVDHGVEPGADREETRVVDSDYTQFALMLSRRHTSRLAVLRISLLGRSWLLPPGTLDQFICLGRAQGLSDDNI Predict reactive species
Full Name: lipocalin 12
Calculated Molecular Weight: 355 aa, 37 kDa
Observed Molecular Weight: 20-22 kDa
GenBank Accession Number: BC041168
Gene Symbol: LCN12
Gene ID (NCBI): 286256
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q6JVE5
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924