Proteintech, 28004-1-AP, LCN12 Polyclonal antibody

Size: 20ul / 150ul The LCN12 (28004-1-AP) by Proteintech is a Polyclonal antibody targeting LCN12 in WB, ELISA applications with reactivity to human, mouse, rat samples 28004-1-AP targets LCN12 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat kidney tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information LCN12 (Lipocalin 12) is an epididymis-specific protein that might play a significant physiological role in male reproduction (PMID: 20692383). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27402 Product name: Recombinant human LCN12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 51-177 aa of BC041168 Sequence: NSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRGQHCDTWSYVLIPAAQPGQFTVDHGVEPGADREETRVVDSDYTQFALMLSRRHTSRLAVLRISLLGRSWLLPPGTLDQFICLGRAQGLSDDNI Predict reactive species Full Name: lipocalin 12 Calculated Molecular Weight: 355 aa, 37 kDa Observed Molecular Weight: 20-22 kDa GenBank Accession Number: BC041168 Gene Symbol: LCN12 Gene ID (NCBI): 286256 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6JVE5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.