Iright
BRAND / VENDOR: Proteintech

Proteintech, 28028-1-AP, PLSCR3 Polyclonal antibody

CATALOG NUMBER: 28028-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PLSCR3 (28028-1-AP) by Proteintech is a Polyclonal antibody targeting PLSCR3 in WB, IHC, ELISA applications with reactivity to Human, Mouse, rat samples 28028-1-AP targets PLSCR3 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, A431 cells, mouse liver tissue, mouse lung tissue, rat kidney tissue, rat liver tissue, rat lung tissue, BxPC-3 cells Positive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PLSCR3, also named as PLS3, belongs to the phospholipid scramblase family. It may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. PLSCR3 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. It is a target of protein kinase C-δ (PKC-δ), resides in mitochondria and plays pivotal roles in regulating apoptotic response. Phosphorylation of PLSCR3 by PKC-δ is involved in the hyperthermia-induced apoptotic signal transduction pathway in Tca8113 cells, and that Hsp27 blocks this pathway to suppress hyperthermia-induced apoptosis. (PMID:20569108) Specification Tested Reactivity: Human, Mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27655 Product name: Recombinant human PLSCR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-295 aa of BC011735 Sequence: MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDRELLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAITS Predict reactive species Full Name: phospholipid scramblase 3 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC011735 Gene Symbol: PLSCR3 Gene ID (NCBI): 57048 RRID: AB_2881040 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRY6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924