Proteintech, 28049-1-AP, TMEM72 Polyclonal antibody

Size: 20ul / 150ul The TMEM72 (28049-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM72 in IHC, ELISA applications with reactivity to Human, mouse samples 28049-1-AP targets TMEM72 in IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive IHC detected in: mouse kidney tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21553 Product name: Recombinant human TMEM72 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 120-275 aa of BC127790 Sequence: LIITGLAYFLLSKRKKRKAAPEVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKKPSALQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPSLAEGLDDGDSEPEETTSDTTPIIPPPQAPLFLSSLTATGLF Predict reactive species Full Name: transmembrane protein 72 Calculated Molecular Weight: 275 aa, 30 kDa GenBank Accession Number: BC127790 Gene Symbol: TMEM72 Gene ID (NCBI): 643236 RRID: AB_3086025 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A0PK05 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.