Iright
BRAND / VENDOR: Proteintech

Proteintech, 28058-1-AP, CD68 Polyclonal antibody

CATALOG NUMBER: 28058-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CD68 (28058-1-AP) by Proteintech is a Polyclonal antibody targeting CD68 in WB, IHC, IF-P, ELISA applications with reactivity to mouse, rat samples 28058-1-AP targets CD68 in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: RAW 264.7 cells, mouse spleen tissue, NR8383 cells Positive IHC detected in: mouse spleen tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:600-1:2000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Mouse CD68 (also known as macrosialin) is a type I transmembrane glycoprotein that is highly and specifically expressed by mouse tissue macrophages, and to a lesser extent by dendritic cells. It belongs to the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family and primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. CD68 is also a member of the scavenger receptor family. It may play a role in phagocytic activities of tissue macrophages. Specification Tested Reactivity: mouse, rat Cited Reactivity: mouse, rat, pig, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27827 Product name: Recombinant mouse Cd68 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-291 aa of NM_001291058 Sequence: MPSPRSKGALGNYTWANGSQPCVQLQAQIQIRILYPIQGGRKAWGISVLNPNKTKVQGGCDGTHPHLSLSFPYGQLTFGFKQDLHQSPSTVYLDYMAVEYNVSFPQAAQWTFMAQNSSLRELQAPLGQSFCCGNASIVLSPAVHLDLLSLRLQAAQLPDKGHFGPCFSCNRDQS Predict reactive species Full Name: CD68 antigen Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: NM_001291058 Gene Symbol: Cd68 Gene ID (NCBI): 12514 RRID: AB_2881049 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31996 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924