Proteintech, 28070-1-AP, NEK6 Polyclonal antibody

Size: 20ul / 150ul The NEK6 (28070-1-AP) by Proteintech is a Polyclonal antibody targeting NEK6 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 28070-1-AP targets NEK6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Positive IHC detected in: rat liver tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The Aspergillus nidulans 'never in mitosis A' (NIMA) is a serine/ threonine kinase that controls initiation of mitosis, whereas its inactivation is necessary for mitotic exit. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA. Human NIMA-related kinase 6 (NEK6, synonym: SID6-1512) is comprised of 338 amino acids and shows both nuclear and cytoplasmic localizations in HeLa cells. NEK6 is required for mitotic progression of human cells. NEK6 is phosphorylated and activated during M phase. Inhibition of Nek6 function by either overexpression of an inactive Nek6 mutant or elimination of endogenous Nek6 by siRNA arrests cells in M phase and triggers apoptosis. Recombinant human NEK6 protein produced in insect cells effectively phosphorylates histones H1 and H3, but not casein. Thus, these results suggest that, unlike other mammalian NIMA-related kinases, NEK6 is a mitotic histone kinase which regulates chromatin condensation in mammalian cells. NEK6 transcripts are ubiquitously expressed with the highest expression found in the heart and skeletal muscle, and the hNek6 gene is localized to human chromosome 9q33-34. NEK6 has four isoforms with MW 35-40 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27887 Product name: Recombinant human NEK6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 174-313 aa of BC000101 Sequence: KPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST Predict reactive species Full Name: NIMA (never in mitosis gene a)-related kinase 6 Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC000101 Gene Symbol: NEK6 Gene ID (NCBI): 10783 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HC98 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.