Iright
BRAND / VENDOR: Proteintech

Proteintech, 28077-1-AP, SPATA9 Polyclonal antibody

CATALOG NUMBER: 28077-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SPATA9 (28077-1-AP) by Proteintech is a Polyclonal antibody targeting SPATA9 in WB, ELISA applications with reactivity to human, mouse, rat samples 28077-1-AP targets SPATA9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27877 Product name: Recombinant human SPATA9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-132 aa of BC047333 Sequence: NFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRGLNSISRSSKSVAKLLHPQLACRLLELRDISGRLLREVNAPRQPLYNIQVRKGSL Predict reactive species Full Name: spermatogenesis associated 9 Calculated Molecular Weight: 254 aa, 29 kDa Observed Molecular Weight: 28-30 kDa GenBank Accession Number: BC047333 Gene Symbol: SPATA9 Gene ID (NCBI): 83890 RRID: AB_3669641 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BWV2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924