Iright
BRAND / VENDOR: Proteintech

Proteintech, 28080-1-AP, MRGPRE Polyclonal antibody

CATALOG NUMBER: 28080-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MRGPRE (28080-1-AP) by Proteintech is a Polyclonal antibody targeting MRGPRE in IHC, ELISA applications with reactivity to Human, rat samples 28080-1-AP targets MRGPRE in IHC, ELISA applications and shows reactivity with Human, rat samples. Tested Applications Positive IHC detected in: rat dorsal root ganglion tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MRGPRE (Mas-related G-protein coupled receptor member E, also named GPR167 ) may regulate nociceptor function or development, including the sensation or modulation of pain. Specification Tested Reactivity: Human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24913 Product name: Recombinant human MRGPRE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 262-311 aa of BC104889 Sequence: AAKPVVYFCLGSAQGRRLPLRLVLQRALGDEAELGAVRETSRRGLVDIAA Predict reactive species Full Name: MAS-related GPR, member E Calculated Molecular Weight: 311 aa, 34 kDa GenBank Accession Number: BC104889 Gene Symbol: MRGPRE Gene ID (NCBI): 116534 RRID: AB_3669642 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86SM8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924