Iright
BRAND / VENDOR: Proteintech

Proteintech, 28084-1-AP, ALG3 Polyclonal antibody

CATALOG NUMBER: 28084-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ALG3 (28084-1-AP) by Proteintech is a Polyclonal antibody targeting ALG3 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples 28084-1-AP targets ALG3 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, human placenta tissue, mouse liver tissue Positive IHC detected in: mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Alpha-1,3-mannosyltransferase (ALG3) encodes an endoplasmic reticulum-localized ALG3 family member that participates in N-glycan synthesis. ALG3 contributes to high mannose-type N-glycans in several cancers, and mannose-type N-glycan upregulation has been shown to be related to cancer progression. ALG3 is overexpressed in oral squamous cell carcinoma(PMID: 33084111), non-small cell lung cancer(PMID: 31899049), and breast cancer(PMID: 33931075) and hepatocellular carcinoma(PMID: 35782861). Specification Tested Reactivity: Human, Mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26382 Product name: Recombinant human ALG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC002839 Sequence: MAAGLRKRGRSGSAAQAEGLCKQWLQRAWQERRLLLREPRYTLLVAACLCLAEVGITFWVIHRVAYTEIDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIRMAQNIFAVLYLATLLLVFLIYHQTCKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMVLLFLSINLLLAQRWGWGCC Predict reactive species Full Name: asparagine-linked glycosylation 3, alpha-1,3- mannosyltransferase homolog (S. cerevisiae) Calculated Molecular Weight: 438 aa, 50 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC002839 Gene Symbol: ALG3 Gene ID (NCBI): 10195 RRID: AB_3669644 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92685 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924