Iright
BRAND / VENDOR: Proteintech

Proteintech, 28091-1-AP, NRSN1 Polyclonal antibody

CATALOG NUMBER: 28091-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NRSN1 (28091-1-AP) by Proteintech is a Polyclonal antibody targeting NRSN1 in WB, ELISA applications with reactivity to human, mouse, rat samples 28091-1-AP targets NRSN1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information NRSN1, also named as VMP and Neuro-p24, is a vesicular membrane protein with MW 24 kDa. It is a unique membranous protein that has a microtubule-binding domain and is specifically expressed in neurons. NRSN1 plays an active role in axonal regeneration as well as in embryonic development and neurite extension. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25972 Product name: Recombinant human NRSN1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 90-195 aa of BC023514 Sequence: IEAFGEADFVVVDTHAVQFNSALDMYKLAGAVLFCIGGTSMAGCLLMSVFVKSYSKEEKFLQQKFKERIADIKAHTQPVTKAPGPGETKIPVTLSRVQNVQPLLAT Predict reactive species Full Name: neurensin 1 Calculated Molecular Weight: 195 aa, 21 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC023514 Gene Symbol: NRSN1 Gene ID (NCBI): 140767 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IZ57 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924