Iright
BRAND / VENDOR: Proteintech

Proteintech, 28094-1-AP, DRD4 Polyclonal antibody

CATALOG NUMBER: 28094-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DRD4 (28094-1-AP) by Proteintech is a Polyclonal antibody targeting DRD4 in WB, ELISA applications with reactivity to Human, Pig, mouse samples 28094-1-AP targets DRD4 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Pig, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, pig brain tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information The family of dopamine receptors (DRs) includes five G protein-coupled receptors (GPCRs)-DRD1, DRD2, DRD3, DRD4 and DRD5-with different anatomical distribution, expression levels, dopamine affinity, signal transduction, and effector targets (PMID:36523297). DRD4 (dopamine receptor D4) influences the postsynaptic action of dopamine and is implicated in many neurological processes, exhibits polymorphism and is one of the most studied genes in connection with psychiatric disorders (PMID:21873960). Moreover, DRD4 modulate glucose metabolism, and protect neurocytes from anoxia/reoxygenation (A/R) injury. Thus, DRD4 might regulate myocardial I/R injury in association with GLUT4-mediated glucose metabolism (PMID:33584304). Specification Tested Reactivity: Human, Pig, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26930 Product name: Recombinant human DRD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 221-320 aa of NM_000797 Sequence: MRWEVARRAKLHGRAPRRPSGPGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRG Predict reactive species Full Name: dopamine receptor D4 Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 40-44 kDa GenBank Accession Number: NM_000797 Gene Symbol: DRD4 Gene ID (NCBI): 1815 RRID: AB_2881058 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21917 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924