Iright
BRAND / VENDOR: Proteintech

Proteintech, 28101-1-AP, DMRTC2 Polyclonal antibody

CATALOG NUMBER: 28101-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DMRTC2 (28101-1-AP) by Proteintech is a Polyclonal antibody targeting DMRTC2 in WB, ELISA applications with reactivity to human samples 28101-1-AP targets DMRTC2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: mouse pancreas tissue, rat pancreas tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Double sex and mab-3-related transcription factors (DMRT) like family C2 (DMRTC2), a member of the DMRT family genes, is involved in the regulation of mammalian sex differentiation and the process of spermatogenesis, particularly meiosis (PMID: 32244802). DMRTC2 is expressed in the testis and pancreas. DMRTC2 has 2 isoforms with the molecular mass of 24 and 39 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27355 Product name: Recombinant human DMRTC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC039266 Sequence: MEPSDMPAGYHCPLDSAPWDETRDPQSTELIPRRAISRSPTCARCRNHGVTAHLKGHKRLCLFQACECHKCVLILERRRVMAAQVALRRQQEAQLKKHLMRRGEASPKAPNHFRKGTTQPQVPSGKENI Predict reactive species Full Name: DMRT-like family C2 Calculated Molecular Weight: 367 aa, 39 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC039266 Gene Symbol: DMRTC2 Gene ID (NCBI): 63946 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IXT2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924