Product Description
Size: 20ul / 150ul
The SLC38A5 (28102-1-AP) by Proteintech is a Polyclonal antibody targeting SLC38A5 in IHC, ELISA applications with reactivity to human, mouse, rat samples
28102-1-AP targets SLC38A5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag27881 Product name: Recombinant human SLC38A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-48 aa of BC019246 Sequence: MELQDPKMNGALPSDAVGYRQEREGFLPSRGPAPGSKPVQFMDFEGKT Predict reactive species
Full Name: solute carrier family 38, member 5
Calculated Molecular Weight: 472 aa, 51 kDa
Observed Molecular Weight: 45 kDa
GenBank Accession Number: BC019246
Gene Symbol: SLC38A5
Gene ID (NCBI): 92745
RRID: AB_2881061
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8WUX1
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924