Iright
BRAND / VENDOR: Proteintech

Proteintech, 28106-1-AP, LIMD1 Polyclonal antibody

CATALOG NUMBER: 28106-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LIMD1 (28106-1-AP) by Proteintech is a Polyclonal antibody targeting LIMD1 in WB, IF/ICC, IP, ELISA applications with reactivity to Human samples 28106-1-AP targets LIMD1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information LIMD1 is a member of the Ajuba family of LIM domain-containing proteins, these kinds of proteins have been shown to play a role in intracellular signaling, transcriptional regulation and cellular differentiation, proliferation and migration (PMID:17174104). LIMD1 predominantly localizes to the cytoplasm especially in the E-cadherin cell-cell adhesive junction, yet also translocates to the nucleus when functions as an RB corepressor (PMID:19060205). And LIMD1 acts as a scaffolding protein to form a PHD-LIMD1-VHL axis, facilitating HIF1α ubiquitination and degradation by the proteasome (PMID:22800800). LIMD1 specifically interacts with retinoblastoma protein (pRB), inhibits E2F-mediated transcription, and suppresses the expression of the majority of genes with E2F1-responsive elements. As a tumor suppressor, LIMD1 blocks tumor growth in vitro and in vivo, and is frequently down-regulated in human lung tumors (PMID:15542589), and it also be detected in normal and breast cancer tissues. LIMD1 protein exists several phosphorylation sites, which may affect its theoretical molecular weight when tested. Proteintech's 28106-1-AP antibody was generated by 133 amino acids, it could recognize the full-length protein in applications. Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27974 Product name: Recombinant human LIMD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 128-260 aa of NM_014240 Sequence: MPPQEQRSRPYLHGTRHGSQDCGSRESLATSEMSAFHQPGPCEDPSCLTHGDYYDNLSLASPKWGDKPGVSPSIGLSVGSGWPSSPGSDPPLPKPCGDHPLNHRQLSLSSSRSSEGSLGGQNSGIGGRSSEKPT Predict reactive species Full Name: LIM domains containing 1 Calculated Molecular Weight: 72 aa Observed Molecular Weight: 72 kDa GenBank Accession Number: NM_014240 Gene Symbol: LIMD1 Gene ID (NCBI): 8994 RRID: AB_2881062 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UGP4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924