Proteintech, 28125-1-AP, NDUFS2 Polyclonal antibody

Size: 20ul / 150ul The NDUFS2 (28125-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFS2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 28125-1-AP targets NDUFS2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, mouse skeletal muscle tissue, rat skeletal muscle tissue Positive IF/ICC detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NDUFS2 (NADH:Ubiquinone Oxidoreductase Core Subunit S2) is a crucial nuclear-encoded protein component of mitochondrial complex I (NADH dehydrogenase), the first and largest complex in the mitochondrial electron transport chain. It functions as part of the enzyme's core matrix arm, directly contributing to the oxidation of NADH, the transfer of electrons to ubiquinone, and the coupled translocation of protons across the inner mitochondrial membrane, which is essential for ATP synthesis. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27078 Product name: Recombinant human NDUFS2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 119-464 aa of BC000170 Sequence: GTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRLLNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLMDDIYQFSKNFSLRLDELEELLTNNRIWRNRTIDIGVVTAEEALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Q reductase) Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC000170 Gene Symbol: NDUFS2 Gene ID (NCBI): 4720 RRID: AB_3669645 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75306 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.