Proteintech, 28138-1-AP, TYROBP/DAP12 Polyclonal antibody

Size: 20ul / 150ul The TYROBP/DAP12 (28138-1-AP) by Proteintech is a Polyclonal antibody targeting TYROBP/DAP12 in WB, ELISA applications with reactivity to human samples 28138-1-AP targets TYROBP/DAP12 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information TYROBP, also known as DAP12 or KARAP, is a transmembrane protein consisting of a very small extracellular region, a transmembrane domain containing an aspartic acid residue critical for association with its partner subunits, and an intracellular domain with a single immunoreceptor tyrosine-based activation motif (ITAM) (PMID: 11114420). It is expressed as a disulfide-bonded homodimer on natural killer cells, myeloid cells and a subset of T cells (PMID: 11114420). TYROBP acts as a signaling adaptor that provides signaling function via the Syk and ZAP-70 tyrosine kinase activation pathways (PMID: 15895090). The gene of TYROBP is located on the long arm of chromosome 19 at position 13.1. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27252 Product name: Recombinant human TYROBP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC011175 Sequence: MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK Predict reactive species Full Name: TYRO protein tyrosine kinase binding protein Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 10-12 kDa GenBank Accession Number: BC011175 Gene Symbol: TYROBP Gene ID (NCBI): 7305 RRID: AB_3669646 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43914 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.