Product Description
Size: 20ul / 150ul
The CENPE (28142-1-AP) by Proteintech is a Polyclonal antibody targeting CENPE in WB, ELISA applications with reactivity to Human samples
28142-1-AP targets CENPE in WB, IHC, ELISA applications and shows reactivity with Human samples.
Tested Applications
Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Specification
Tested Reactivity: Human
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag27230 Product name: Recombinant human CENPE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2401-2500 aa of NM_001286734 Sequence: MESKIIKMQKELEVTNDIIAKLQAKVHESNKCLEKTKETIQVLQDKVALGAKPYKEEIEDLKMKLVKIDLEKMKNAKEFEKEISATKATVEYQKEVIRLLR Predict reactive species
Full Name: centromere protein E, 312kDa
Calculated Molecular Weight: 316 kDa
Observed Molecular Weight: 300-316 kDa
GenBank Accession Number: NM_001286734
Gene Symbol: CENPE
Gene ID (NCBI): 1062
RRID: AB_2881072
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q02224
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924