Proteintech, 28145-1-AP, DOT1L Polyclonal antibody

Size: 20ul / 150ul The DOT1L (28145-1-AP) by Proteintech is a Polyclonal antibody targeting DOT1L in WB, ELISA applications with reactivity to human, rat samples 28145-1-AP targets DOT1L in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: PC-12 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information DOT1L (Disruptor of telomeric silencing 1-like) is the only known histone methyltransferse catalyzing H3K79 methylation which is an activating mark for gene transcription by promoting transcriptional elongation (PMID: 34187895). DOT1L forms a complex with AF10/AF17 and ENL/AF9, is dysregulated in mixed-lineage leukemia (MLLr), and is believed to regulate transcriptional elongation without direct evidence. DOT1L has been reported to directly interact with RNAPII phosphorylated on Ser2 and/or Ser5 of the C-terminal domain (CTD) of its largest subunit. Loss of Dot1L results in yolk sac angiogenesis defects and embryonic lethality (PMID: 18787701). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27229 Product name: Recombinant human DOT1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 511-698 aa of NM_032482 Sequence: MLQELLGQEKEKNAQLLGAAQQLLSHCQAQKEEIRRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQSEQLEQDNRALRGQSLQLLKARCEELQLDWATLSLEKLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQELLQLKSCVPPDDALSLHLRGKGALGRELEPDASRLHLELDCTK Predict reactive species Full Name: DOT1-like, histone H3 methyltransferase (S. cerevisiae) Calculated Molecular Weight: 185 kDa Observed Molecular Weight: 185~200 kDa GenBank Accession Number: NM_032482 Gene Symbol: DOT1L Gene ID (NCBI): 84444 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TEK3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.