Proteintech, 28151-1-AP, PTPRK Polyclonal antibody

Size: 20ul / 150ul The PTPRK (28151-1-AP) by Proteintech is a Polyclonal antibody targeting PTPRK in WB, ELISA applications with reactivity to Human, mouse, rat samples 28151-1-AP targets PTPRK in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse spleen tissue, rat spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information PTPRK (Protein Tyrosine Phosphatase Receptor Type Kappa), a member of the receptor-type protein tyrosine phosphatase family, is a transmembrane protein that regulates cell-cell contact. PTPRK is a 210 kDa precursor protein and converted by furin to a mature heterodimeric protein composed of a non-covalently attached amino-terminal extracellular subunit (E-subunit, 120 kDa) and carboxyl-terminal transmembrane subunit (P-subunit, 95 kDa) (PMID: 24882578, 16648485). Loss of PTPRK activity has been observed in pancreatic cancer, primary CNS lymphoma and melanoma, and is associated with poor survival of cancer patients, which suggest that PTPRK is a potential tumor suppressor (PMID: 23696788). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27765 Product name: Recombinant human PTPRK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 635-750 aa of BC140775 Sequence: EELHPHRTKREAGAMECYQVPVTYQNAMSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQGFWNPPLAPRKGYNIYFQAMSSVEKETKTQCVRIATKAAATEEPEVIPDPAKQTDR Predict reactive species Full Name: protein tyrosine phosphatase, receptor type, K Calculated Molecular Weight: 1439 aa, 162 kDa Observed Molecular Weight: 100-120 kDa GenBank Accession Number: BC140775 Gene Symbol: PTPRK Gene ID (NCBI): 5796 RRID: AB_2881074 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15262 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.