Iright
BRAND / VENDOR: Proteintech

Proteintech, 28153-1-AP, TENC1 Polyclonal antibody

CATALOG NUMBER: 28153-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TENC1 (28153-1-AP) by Proteintech is a Polyclonal antibody targeting TENC1 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 28153-1-AP targets TENC1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse heart tissue, rat heart tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27731 Product name: Recombinant human TENC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 508-724 aa of BC142668 Sequence: SVSSDSGHSSTLTTEPAAESPGRPPPTAAERQELDRLLGGCGVASGGRGAGRETAILDDEEQPTVGGGPHLGVYPGHRPGLSRHCSCRQGYREPCGVPNGGYYRPEGTLERRRLAYGGYEGSPQGYAEASMEKRRLCRSLSEGLYPYPPEMGKPATGDFGYRAPGYREVVILEDPGLPALYPCPACEEKLALPTAALYGLRLEREAGEGWASEAGKP Predict reactive species Full Name: tensin like C1 domain containing phosphatase (tensin 2) Calculated Molecular Weight: 1419 aa, 154 kDa Observed Molecular Weight: 140-153 kDa GenBank Accession Number: BC142668 Gene Symbol: TENC1 Gene ID (NCBI): 23371 RRID: AB_3086032 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q63HR2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924