Proteintech, 28154-1-AP, PLEKHH3 Polyclonal antibody

Size: 20ul / 150ul The PLEKHH3 (28154-1-AP) by Proteintech is a Polyclonal antibody targeting PLEKHH3 in WB, ELISA applications with reactivity to Human, Mouse samples 28154-1-AP targets PLEKHH3 in WB, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: LNCaP cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information PLEKHH3, a gene related to endothelial tight junction, is associated with obstructive sleep apnea (OSA) and angiogenesis. It has been reported that the expression of PLEKHH3 protein was increased in the OSA patients. PLEKHH3 may play a key role in OSA and angiogenesis by specifically regulating the endothelial cells formation of tight junctions. 28154-1-AP detects the isoforms of PLEKHH3 protein around 80-85 kDa in SDS-PAGE.(PMID:28520763) Specification Tested Reactivity: Human, Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28001 Product name: Recombinant human PLEKHH3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 251-404 aa of BC052978 Sequence: YGVSAPGPGYAPLREEAVRLFLALQALEGARRPGPLMQGVLQTCRDLPALRDELFLQLAKQTSGPAGPPGLPATQDPAALRYWQLLTCMSCTFRPGGAVRGHLLGHLERTEQALPDSELAEYARFIRKALGRTRGRELVPSLAEISALSQRQEL Predict reactive species Full Name: pleckstrin homology domain containing, family H (with MyTH4 domain) member 3 Calculated Molecular Weight: 793 aa, 85 kDa Observed Molecular Weight: 85 and 80 kDa GenBank Accession Number: BC052978 Gene Symbol: PLEKHH3 Gene ID (NCBI): 79990 RRID: AB_2881076 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z736 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.