Proteintech, 28169-1-AP, CDADC1 Polyclonal antibody

Size: 20ul / 150ul The CDADC1 (28169-1-AP) by Proteintech is a Polyclonal antibody targeting CDADC1 in IHC, IF/ICC, ELISA applications with reactivity to Human, mouse samples 28169-1-AP targets CDADC1 in IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive IHC detected in: human testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Saos-2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CDADC1 (cytidine and dCMP deaminase domain containing 1) catalyzes the deamination of cytidine and deoxycytidine into uridine and deoxyuridine, respectively, and may play an important role in testicular development and spermatogenesis (PMID: 26945630, 16955368). Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27374 Product name: Recombinant human CDADC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-188 aa of BC125202 Sequence: PAEAQRQKSQKNEEGKHGPLGDNEERTRVSTDKRQVKRTGLVVVKNMKIVGLHCSSEDLHAGQIALIKHGSRLKNCDLYFSRKPCSACLKMIVNAGVNRISYWPADPEISLLTEASSSEDAKLDAKAVERLKSNSRAHV Predict reactive species Full Name: cytidine and dCMP deaminase domain containing 1 Calculated Molecular Weight: 514 aa, 58 kDa GenBank Accession Number: BC125202 Gene Symbol: CDADC1 Gene ID (NCBI): 81602 RRID: AB_3086034 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BWV3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.