Proteintech, 28175-1-AP, APH1B Polyclonal antibody

Size: 20ul / 150ul The APH1B (28175-1-AP) by Proteintech is a Polyclonal antibody targeting APH1B in WB, ELISA applications with reactivity to human, mouse, rat samples 28175-1-AP targets APH1B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: fetal human brain tissue, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14066 Product name: Recombinant human APH1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 196-257 aa of BC020905 Sequence: HLLVSAQTFISSYYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR Predict reactive species Full Name: anterior pharynx defective 1 homolog B (C. elegans) Calculated Molecular Weight: 257 aa, 28 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC020905 Gene Symbol: APH1B Gene ID (NCBI): 83464 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WW43 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.