Proteintech, 28190-1-AP, ZC3H14 Polyclonal antibody

Size: 20ul / 150ul The ZC3H14 (28190-1-AP) by Proteintech is a Polyclonal antibody targeting ZC3H14 in WB, IP, ELISA applications with reactivity to human, mouse samples 28190-1-AP targets ZC3H14 in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IP detected in: HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28182 Product name: Recombinant human ZC3H14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 120-369 aa of NM_001160103 Sequence: MPSARPEKRDSRVSTSSQESKTTNVRQTYDDGAATRLMSTVKPLREPAPSEDVIDIKPEPDDLIDEDLNFVQENPLSQKKPTVTLTYGSSRPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVSSVVKVKKFNHDGEEEEEDDDYGSRTGSISSSVSVPAKPERRPSLPPSKQANKNLILKAISEAQESVTKT Predict reactive species Full Name: zinc finger CCCH-type containing 14 Calculated Molecular Weight: 83 aa Observed Molecular Weight: 68 kDa GenBank Accession Number: NM_001160103 Gene Symbol: ZC3H14 Gene ID (NCBI): 79882 RRID: AB_2881085 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6PJT7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.