Proteintech, 28197-1-AP, ETV1 Polyclonal antibody

Size: 20ul / 150ul The ETV1 (28197-1-AP) by Proteintech is a Polyclonal antibody targeting ETV1 in WB, ELISA applications with reactivity to human, mouse samples 28197-1-AP targets ETV1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ETV1(Ets variant 1) is a member of ETS transcription factor family, which has become the research focus in cancer and cardiac electrophysiology in recent years. TMPRSS2-ETV1 gene fusion exists in about 1-2% of prostate cancer, while ETV1 is highly expressed in 5-10% of advanced tumors. Different from sibling factor ERG, ETV1 not only enhances the signal of androgen receptor (AR), but also can autonomously activate testosterone synthesis and cholesterol/lipid metabolism reprogramming, cooperate with PTEN deficiency to promote the progress of local cancer to invasive adenocarcinoma, and predict higher Gleason score and poor prognosis, so it is regarded as an invasive subtype marker of "metabolism-transcription dual drive". Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28158 Product name: Recombinant human ETV1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 71-213 aa of BC098403 Sequence: VPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQR Predict reactive species Full Name: ets variant 1 Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC098403 Gene Symbol: ETV1 Gene ID (NCBI): 2115 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P50549 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.