Proteintech, 28201-1-AP, ASK1 Polyclonal antibody

Size: 20ul / 150ul The ASK1 (28201-1-AP) by Proteintech is a Polyclonal antibody targeting ASK1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 28201-1-AP targets ASK1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, A431 cells, BxPC-3 cells Positive IP detected in: HeLa cells Positive IHC detected in: human pancreas cancer tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information ASK1(Apoptosis signal-regulating kinase 1) is also named as MAP3K5, MAPKKK5, MEKK5 and belongs to the MAP kinase kinase kinase subfamily. It is an evolutionarily conserved mitogen activated protein 3-kinase that activates both Jnk and p38 mitogen-activated protein kinases. ASK1 is activated in response to various cytotoxic stresses including TNF, Fas and reactive oxygen species (ROS) such as H2O2, and activates c-Jun NH 2-terminal kinase (JNK) and p38. 28201-1-AP antibody detects the 155 kDa band in SDS-PAGE. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28092 Product name: Recombinant human ASK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1180-1374 aa of BC054503 Sequence: LASESDTADQEDLDVEDDHEEQPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT Predict reactive species Full Name: mitogen-activated protein kinase kinase kinase 5 Calculated Molecular Weight: 155 kDa Observed Molecular Weight: 155 kDa GenBank Accession Number: BC054503 Gene Symbol: ASK1 Gene ID (NCBI): 4217 RRID: AB_2782957 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99683 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.