Product Description
Size: 20ul / 150ul
The NPPB (28214-1-AP) by Proteintech is a Polyclonal antibody targeting NPPB in IHC, ELISA applications with reactivity to human, mouse, rat samples
28214-1-AP targets NPPB in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive IHC detected in: mouse heart tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
NPPB, also known as B-type natriuretic peptide (BNP), is a cardiac hormone that is secreted mainly in the ventricles in response to increased wall stress. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. BNP is a marker of systolic and diastolic dysfunction and a strong predictor of mortality in heart failure patients.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag28133 Product name: Recombinant human BNP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-134 aa of BC025785 Sequence: HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH Predict reactive species
Full Name: natriuretic peptide precursor B
Calculated Molecular Weight: 134 aa, 15 kDa
GenBank Accession Number: BC025785
Gene Symbol: BNP
Gene ID (NCBI): 4879
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P16860
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924