Proteintech, 28218-1-AP, FSTL3/FLRG Polyclonal antibody

Size: 20ul / 150ul The FSTL3/FLRG (28218-1-AP) by Proteintech is a Polyclonal antibody targeting FSTL3/FLRG in WB, IHC, ELISA applications with reactivity to human, rat samples 28218-1-AP targets FSTL3/FLRG in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: human placenta tissue, HeLa cells Positive IHC detected in: human urothelial carcinoma tissue, rat kidney tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Follistatin‐like 3 (FSTL3) is a highly conserved 27-39 kDa monomeric glycoprotein belonging to the follistatin protein family and it is primarily expressed in the placenta as well as in the testis, heart, adipose tissue, and pancreas. It is an extracellular inhibitor of the transforming growth factor beta (TGF‐β) family ligands, including activin, myostatin, and bone morphogenetic proteins. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27626 Product name: Recombinant human FSTL3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 94-263 aa of BC005839 Sequence: PCKDSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQELCGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCAGTPEEPPGGESAEEEENFV Predict reactive species Full Name: follistatin-like 3 (secreted glycoprotein) Calculated Molecular Weight: 263 aa, 28 kDa Observed Molecular Weight: 28-33 kDa GenBank Accession Number: BC005839 Gene Symbol: FSTL3 Gene ID (NCBI): 10272 RRID: AB_3086037 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95633 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.