Iright
BRAND / VENDOR: Proteintech

Proteintech, 28236-1-AP, CREG2 Polyclonal antibody

CATALOG NUMBER: 28236-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CREG2 (28236-1-AP) by Proteintech is a Polyclonal antibody targeting CREG2 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 28236-1-AP targets CREG2 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The cellular repressor of E1A-stimulated genes (CREG) is a secreted glycoprotein that promotes the differentiation of pluripotent stem cells. CREG2 is a promising biological indicator because it plays an important role in increasing the migratory and proliferative capacity of lung adenocarcinoma (LUAD) cells (PMID: 40676398). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28242 Product name: Recombinant human CREG2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 42-215 aa of BC032949 Sequence: VTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAHLRPRAGAARARQPPAPPGMFSYRREGGQTASAPPGPRLRAATARSLAHASVWGCLATVSTHKKIQGLPFGNCLPVSDGPFNNSTGIPFFYMTAKDPVVADLMKNPMASLMLPESEGEFCRKNIVDPEDPRC Predict reactive species Full Name: cellular repressor of E1A-stimulated genes 2 Calculated Molecular Weight: 32 kDa GenBank Accession Number: BC032949 Gene Symbol: CREG2 Gene ID (NCBI): 200407 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IUH2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924