Proteintech, 28271-1-AP, SFRP1 Polyclonal antibody

Size: 20ul / 150ul The SFRP1 (28271-1-AP) by Proteintech is a Polyclonal antibody targeting SFRP1 in WB, ELISA applications with reactivity to Human samples 28271-1-AP targets SFRP1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28072 Product name: Recombinant human SFRP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 154-314 aa of BC036503 Sequence: MLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK Predict reactive species Full Name: secreted frizzled-related protein 1 Calculated Molecular Weight: 314 aa, 35 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC036503 Gene Symbol: SFRP1 Gene ID (NCBI): 6422 RRID: AB_2881100 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N474 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.