Proteintech, 28289-1-AP, IPO7 Polyclonal antibody

Size: 20ul / 150ul The IPO7 (28289-1-AP) by Proteintech is a Polyclonal antibody targeting IPO7 in WB, IHC, ELISA applications with reactivity to Human samples 28289-1-AP targets IPO7 in WB, IHC, IF, IP, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, U-251 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27257 Product name: Recombinant human IPO7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 879-1016 aa of NM_006391.2 Sequence: MHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGG Predict reactive species Full Name: importin 7 Calculated Molecular Weight: 120 kDa Observed Molecular Weight: 120-130 kDa GenBank Accession Number: NM_006391.2 Gene Symbol: IPO7 Gene ID (NCBI): 10527 RRID: AB_2881106 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95373 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.