Iright
BRAND / VENDOR: Proteintech

Proteintech, 28293-1-AP, BPIFA2 Polyclonal antibody

CATALOG NUMBER: 28293-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BPIFA2 (28293-1-AP) by Proteintech is a Polyclonal antibody targeting BPIFA2 in WB, ELISA applications with reactivity to Human samples 28293-1-AP targets BPIFA2 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: human saliva Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: Human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27401 Product name: Recombinant human C20orf70 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-123 aa of BC065726 Sequence: TGTSESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGL Predict reactive species Full Name: chromosome 20 open reading frame 70 Calculated Molecular Weight: 249 aa, 27 kDa Observed Molecular Weight: 30-37 kDa GenBank Accession Number: BC065726 Gene Symbol: BPIFA2 Gene ID (NCBI): 140683 RRID: AB_2881107 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96DR5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924