Iright
BRAND / VENDOR: Proteintech

Proteintech, 28301-1-AP, FOXJ2 Polyclonal antibody

CATALOG NUMBER: 28301-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FOXJ2 (28301-1-AP) by Proteintech is a Polyclonal antibody targeting FOXJ2 in WB, ELISA applications with reactivity to human samples 28301-1-AP targets FOXJ2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HuH-7 cells, U-87 MG cells, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Fork head box J2 (FOXJ2) is a transcription factor discovered in mammals and other vertebrates in 2000, which belongs to the Fork head box (Fox) transcription factor family, which shares a conserved DNA-binding domain, known as Fork Head. FOXJ2 participates in the regulation of cell proliferation, differentiation, and migration by targeting downstream genes through its DNA binding domain, and plays fundamental roles in embryonic development, tumorigenesis, and the progression of certain cancers. The expression patterns of FOXJ2 have been reported to be aberrant in a variety of cancers, including breast cancer, extra-hepatic cholangiocarcinoma, nasopharyngeal carcinoma, glioma, and non-small cell lung cancer (PMID: 28769576, PMID: 33725831, PMID: 35908066). This antibody has been validated for knockdown. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27345 Product name: Recombinant human FOXJ2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 145-271 aa of BC136305 Sequence: CPDISRKRRHPPDDDLSQDSPEQEASKSPRGGVAGSGEASLPPEGNPQMSLQSPTSIASYSQGTGSVDGGAVAAGASGRESAEGPPPLYNTNHDFKFSYSEINFQDLSWSFRNLYKSMLEKSSSSSQ Predict reactive species Full Name: forkhead box J2 Calculated Molecular Weight: 574 aa, 62 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC136305 Gene Symbol: FOXJ2 Gene ID (NCBI): 55810 RRID: AB_3669651 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P0K8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924