Iright
BRAND / VENDOR: Proteintech

Proteintech, 28303-1-AP, ENPP3/CD203c Polyclonal antibody

CATALOG NUMBER: 28303-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ENPP3/CD203c (28303-1-AP) by Proteintech is a Polyclonal antibody targeting ENPP3/CD203c in WB, ELISA applications with reactivity to human, rat samples 28303-1-AP targets ENPP3/CD203c in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat small intestine tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ENPP3/CD203c is part of ectonucleotide pyrophosphatases/phosphodiesterase (ENPP) family and plays a role in various physiological processes. Increased levels of ENPP3 have been observed in conditions, such as clear cell renal cell carcinoma, bile duct carcinoma, and colorectal cancer, positioning ENPP3 as a potential tumor marker (PMID: 38749434). Mice harboring a point mutant of ENPP3 that specifically abolishes its cGAMP hydrolase activity are more resistant to both primary tumor growth and metastasis in certain cancers (PMID: 38149831). High molecular weight band is the glycosylated form of ENPP3 (PMID: 27665743, 30271993) Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28478 Product name: Recombinant human ENPP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 344-512 aa of BC146579 Sequence: VVDHAFGMLMEGLKQRNLHNCVNIILLADHGMDQTYCNKMEYMTDYFPRINFFYMYEGPAPRIRAHNIPHDFFSFNSEEIVRNLSCRKPDQHFKPYLTPDLPKRLHYAKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPF Predict reactive species Full Name: ectonucleotide pyrophosphatase/phosphodiesterase 3 Calculated Molecular Weight: 875 aa, 100 kDa Observed Molecular Weight: 120-150 kDa GenBank Accession Number: BC146579 Gene Symbol: ENPP3 Gene ID (NCBI): 5169 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14638 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924