Iright
BRAND / VENDOR: Proteintech

Proteintech, 28318-1-AP, PDS5B Polyclonal antibody

CATALOG NUMBER: 28318-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PDS5B (28318-1-AP) by Proteintech is a Polyclonal antibody targeting PDS5B in WB, ELISA applications with reactivity to human, mouse samples 28318-1-AP targets PDS5B in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: PC-3 cells, SKOV-3 cells, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information PDS5B (PDS5 Cohesin Scc1-like Protein B) is a protein associated with sister chromatid cohesion and maintenance of chromosome structure. It plays a significant role in cell cycle regulation, DNA repair, and gene expression. PDS5B interacts with the cohesin complex to ensure the proper separation of sister chromatids during cell division. Additionally, PDS5B is crucial in DNA damage repair, particularly during homologous recombination, helping to maintain genomic stability. It also indirectly affects gene expression and chromatin structure by modulating the function of the cohesin complex. PDS5B is widely expressed during embryonic development and is highly expressed in the brain and testes in adulthood. Its dysfunction is associated with multiple diseases, including Cohesinopathies and Cornelia de Lange syndrome. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27977 Product name: Recombinant human PDS5B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1139-1310 aa of NM_015032 Sequence: MSSAGKQSQTKSSRMETVSNASSSSNPSSPGRIKGRLDSSEMDHSENEDYTMSSPLPGKKSDKRDDSDLVRSELEKPRGRKKTPVTEQEEKLGMDDLTKLVQEQKPKGSQRSRKRGHTASESDEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKT Predict reactive species Full Name: PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae) Calculated Molecular Weight: 165 aa Observed Molecular Weight: 150 kDa GenBank Accession Number: NM_015032 Gene Symbol: PDS5B Gene ID (NCBI): 23047 RRID: AB_2881111 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NTI5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924