Proteintech, 28322-1-AP, GIPR Polyclonal antibody

Size: 20ul / 150ul The GIPR (28322-1-AP) by Proteintech is a Polyclonal antibody targeting GIPR in WB, IHC, ELISA applications with reactivity to human, mouse samples 28322-1-AP targets GIPR in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HT-1080 cells, K-562 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GIPR, or Gastric Inhibitory Polypeptide Receptor, plays a crucial role in glucose metabolism and insulin secretion. It is a G protein-coupled receptor (GPCR). It belongs to the B1 class of this receptor family, which is involved in various physiological processes including fat generation, pancreatic beta-cell proliferation, and insulin release. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28143 Product name: Recombinant human GIPR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 401-466 aa of BC093723 Sequence: SEIRRGWHHCRLRRSLGEEQRQLPERAFRALPSGSGPGEVPTSRGLSSGTLPGPGNEASRELESYC Predict reactive species Full Name: gastric inhibitory polypeptide receptor Calculated Molecular Weight: 466 aa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC093723 Gene Symbol: GIPR Gene ID (NCBI): 2696 RRID: AB_2881113 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48546 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.