Proteintech, 28328-1-AP, UBE2D1/2/3/4 Polyclonal antibody

Size: 20ul / 150ul The UBE2D1/2/3/4 (28328-1-AP) by Proteintech is a Polyclonal antibody targeting UBE2D1/2/3/4 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples 28328-1-AP targets UBE2D1/2/3/4 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HEK-293 cells, MCF-7 cells, NIH/3T3 cells, mouse testis tissue, mouse kidney tissue, rat kidney tissue, PC-12 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Ubiquitination is a post-translational modification pathway or is part of the specific protein-degradation pathway by the 26S proteasome. Ubiquitination of a target protein involves multistep enzymatic reaction catalyzed by a cascade of enzymes including Ub-activating enzymes (E1s), Ub-conjugating enzymes (E2s) and Ub ligases (E3s) (PMID: 23542885). UBE2D family, which has 4 members named as UBE2D1/2/3/4, is an E2 ubiquitin-conjugating enzyme family in the ubiquitin-proteasome system. This antibody can recognize all the four members of UBE2D due to the high homology. Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28736 Product name: Recombinant human UBE2D2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC033349 Sequence: MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTD Predict reactive species Full Name: ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 14-17 kDa GenBank Accession Number: BC033349 Gene Symbol: UBE2D2 Gene ID (NCBI): 7322 RRID: AB_2881114 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62837 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.