Iright
BRAND / VENDOR: Proteintech

Proteintech, 28338-1-AP, TOX3 Polyclonal antibody

CATALOG NUMBER: 28338-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TOX3 (28338-1-AP) by Proteintech is a Polyclonal antibody targeting TOX3 in WB, ELISA applications with reactivity to human, mouse samples 28338-1-AP targets TOX3 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TOX3, also known as TNRC9 (trinucleotide repeat containing 9), is a neuronal transcription factor containing a nuclear localization signal and a high mobility group (HMG)-box domain followed by a C-terminal poly-glutamine stretch. TOX3 is specifically expressed in the estrogen receptor alpha positive (ER+) subset of murine mammary luminal epithelial cells, including a recently identified progenitor cell subset (PMID: 19196971). TOX3 expression is negatively correlated with the immunotherapy targets PD-1, PD-L1 and HAVCR2 in lung adenocarcinoma, indicating that it serves a role in immunity activation (PMID: 27080130). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28251 Product name: Recombinant human TOX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of NM_001080430 Sequence: MDVRFYPAAAGDPASLDFAQCLGYYGYSKFGNNNNYMNMAEANNAFFAASEQTFHTPSLGDEEFEIPPITPPPESDPALGMPDVLLPFQALSDPLPSQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSG Predict reactive species Full Name: TOX high mobility group box family member 3 Calculated Molecular Weight: 63 aa Observed Molecular Weight: 63 kDa GenBank Accession Number: NM_001080430 Gene Symbol: TOX3 Gene ID (NCBI): 27324 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15405 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924