Iright
BRAND / VENDOR: Proteintech

Proteintech, 28371-1-AP, AURKA Polyclonal antibody

CATALOG NUMBER: 28371-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The AURKA (28371-1-AP) by Proteintech is a Polyclonal antibody targeting AURKA in WB, IF/ICC, ELISA applications with reactivity to human samples 28371-1-AP targets AURKA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, SW 1990 cells Positive IF/ICC detected in: Caco-2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information AURKA(Aurora kinase A), also named as STK6, STK15 or AIK, belongs to the Ser/Thr protein kinase family. This protein may play a role in cell cycle regulation during anaphase and/or telophase by being involved in microtubule formation and/or stabilization. Some recent evidence revealed that AURKA may also be implicated in tumor development and progression. AURKA is expressed highly in testis and various proliferating cells, migrating as a 46 kDa protein in SDS PAGE.Nuclear staining for AURKA is weak or nonexistent in normal tissue but strong in tumor tissue(PMID:19107951). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29006 Product name: Recombinant human AURKA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC002499 Sequence: MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALED Predict reactive species Full Name: aurora kinase A Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC002499 Gene Symbol: AURKA Gene ID (NCBI): 6790 RRID: AB_3086047 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14965 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924