Proteintech, 28390-1-AP, KAT2A/GCN5 Polyclonal antibody

Size: 20ul / 150ul The KAT2A/GCN5 (28390-1-AP) by Proteintech is a Polyclonal antibody targeting KAT2A/GCN5 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 28390-1-AP targets KAT2A/GCN5 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HUVEC cells, HeLa cells, LNCaP cells, MCF-7 cells Positive IP detected in: LNCaP cells, hTERT-RPE1 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information GCN5, encoded by KAT2A, is a member of nuclear A-type histone acetyltransferase (HAT) which has direct impact on gene transcription. Additionally, GCN5 has roles in cell cycle regulation, DNA replication, and DNA repair, highlighting it as key player in the maintenance of genome stability. GCN5 is a coactivator of c-MYC oncogene protein and has oncogenic roles in various cancers. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29005 Product name: Recombinant human KAT2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 366-449 aa of BC032743 Sequence: EIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLR Predict reactive species Full Name: K(lysine) acetyltransferase 2A Calculated Molecular Weight: 94 kDa Observed Molecular Weight: 94 kDa GenBank Accession Number: BC032743 Gene Symbol: KAT2A Gene ID (NCBI): 2648 RRID: AB_3669658 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92830 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.