Iright
BRAND / VENDOR: Proteintech

Proteintech, 28403-1-AP, TAOK3 Polyclonal antibody

CATALOG NUMBER: 28403-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TAOK3 (28403-1-AP) by Proteintech is a Polyclonal antibody targeting TAOK3 in WB, ELISA applications with reactivity to Human samples 28403-1-AP targets TAOK3 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information TAOK3 (Serine/threonine-protein kinase TAO3) is also named as DPK, JIK, KDS, MAP3K18. It belongs to the STE Ser/Thr protein kinase family. TAOK3 acts as an activator of the p38/MAPK14 stress-activated MAPK cascade. In response to DNA damage, it is involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of upstream MAP2K3 and MAP2K6 kinases. The protein can also be autophosphorylated (PMID:20949042). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29158 Product name: Recombinant human TAOK3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 366-430 aa of BC002756 Sequence: SMQEVMDESSSELVMMHDDESTINSSSSVVHKKDHVFIRDEAGHGDPRPEPRPTQSVQSQALHYR Predict reactive species Full Name: TAO kinase 3 Calculated Molecular Weight: 105 kDa Observed Molecular Weight: 100-105 kDa GenBank Accession Number: BC002756 Gene Symbol: TAOK3 Gene ID (NCBI): 51347 RRID: AB_2918158 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H2K8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924