Proteintech, 28411-1-AP, ORAI1 Polyclonal antibody

Size: 20ul / 150ul The ORAI1 (28411-1-AP) by Proteintech is a Polyclonal antibody targeting ORAI1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 28411-1-AP targets ORAI1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MDA-MB-453s cells, MCF-7 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Store-operated calcium channels (SOCs) play essential functions in various physiological processes. ORAI1 is a complex glycosylated protein, it exists in several molecular weight forms: a theoretical molecular weight of 32.7 kDa of the unmodified protein and two major glycosylated proteins of ~43 kDa and ~50 kDa (PMID: 22318387). Human patients with a severe combinaed immunodeficiency (SCID) syndrome possess point mutations in Orai1 gene. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29234 Product name: Recombinant human ORAI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 200-275 aa of BC015369 Sequence: LPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQAAAIASTTIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNE Predict reactive species Full Name: ORAI calcium release-activated calcium modulator 1 Calculated Molecular Weight: 301 aa, 33 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: BC015369 Gene Symbol: ORAI1 Gene ID (NCBI): 84876 RRID: AB_2918160 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96D31 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.