Iright
BRAND / VENDOR: Proteintech

Proteintech, 28441-1-AP, IFT172 Polyclonal antibody

CATALOG NUMBER: 28441-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IFT172 (28441-1-AP) by Proteintech is a Polyclonal antibody targeting IFT172 in WB, IHC, IF/ICC, ELISA applications with reactivity to mouse, rat, human samples 28441-1-AP targets IFT172 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with mouse, rat, human samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue, mouse brain tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: ARPE-19 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: mouse, rat, human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28921 Product name: Recombinant human IFT172 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1206-1408 aa of BC137126 Sequence: QARGALEEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPSQLEALQEEYEREATKKGARGVEGFVEQARHWEQAGEYSRAVDCYLKVRDSGNSGLAEKCWMKAAELSIKFLPPQRNMEVVLAVGPQLIGIGKHSAAAELYLNLDLVKEAIDAFIEGEEWNKAKRVAKELDPRYEDYVDQHYKEFLKNQGKVDS Predict reactive species Full Name: intraflagellar transport 172 homolog (Chlamydomonas) Calculated Molecular Weight: 1749 aa, 198 kDa Observed Molecular Weight: 180 kDa GenBank Accession Number: BC137126 Gene Symbol: IFT172 Gene ID (NCBI): 26160 RRID: AB_2881142 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UG01 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924