Proteintech, 28447-1-AP, NCX1 Polyclonal antibody

Size: 20ul / 150ul The NCX1 (28447-1-AP) by Proteintech is a Polyclonal antibody targeting NCX1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 28447-1-AP targets NCX1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue, rat kidney tissue, mouse kidney tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:1600 Background Information SLC8A1, also known as NCX1, belongs to the SLC (Solute Carrier) family and the CaCA (Calcium/Cation Antiporter) superfamily. NCX1 is a bidirectional ion exchanger that can exchange sodium and calcium ions between the inside and outside of cells in a 1:3 ratio (1 Ca2+ ion and 3 Na+ ions). Under physiological conditions, NCX1 mainly transports Ca2+ from the cell interior to the exterior through the forward transport mode to maintain the low calcium level inside the cell. However, under certain special conditions, such as ischemia-reperfusion injury and stroke, the reverse transport mode of NCX1 is activated, leading to the influx of Ca2+ into the cell, which may cause cell damage (PMID: 21289289, 30686898). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28952 Product name: Recombinant human SLC8A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-59 aa of NM_021097 Sequence: MYNMRRLSLSPTFSMGFHLLVTVSLLFSHVDHVIAETEMEGEGNETGECTGSYYCKKGV Predict reactive species Full Name: solute carrier family 8 (sodium/calcium exchanger), member 1 Calculated Molecular Weight: 109 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_021097 Gene Symbol: NCX1 Gene ID (NCBI): 6546 RRID: AB_2918167 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P32418 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.