Proteintech, 28454-1-AP, SGK1 Polyclonal antibody

Size: 20ul / 150ul The SGK1 (28454-1-AP) by Proteintech is a Polyclonal antibody targeting SGK1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 28454-1-AP targets SGK1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IHC detected in: mouse kidney tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:400 Background Information Serum- and glucocorticoid-induced kinase 1 (SGK1),also named as SGK, is a S/T protein kinase that belongs to the AGC (cAMP-dependent, cGMP-dependent, and protein kinase C) kinase family. It is expressed in many cell types and participates in numerous cellular processes and it is ubiquitinated and degraded at the ER membrane(PMID: 16847254). The N-terminal motif of SGK1 is critical for its ubiquitination and degradation(PMID:16817852 ). SGK and Akt are likely to phosphorylate related substrates, as they share a similar consensus phosphorylation site (RXRXXS/T)(PMID:11154281). It has 5 isoforms produced by alternative promoter usage and alternative splicing. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29420 Product name: Recombinant human SGK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-82 aa of BC001263 Sequence: MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQ Predict reactive species Full Name: serum/glucocorticoid regulated kinase 1 Calculated Molecular Weight: 431 aa, 49 kDa Observed Molecular Weight: 42-50 kDa GenBank Accession Number: BC001263 Gene Symbol: SGK1 Gene ID (NCBI): 6446 RRID: AB_2881145 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00141 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.